Iright
BRAND / VENDOR: Proteintech

Proteintech, 60966-4-Ig, FHL3 Monoclonal antibody

CATALOG NUMBER: 60966-4-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FHL3 (60966-4-Ig) by Proteintech is a Monoclonal antibody targeting FHL3 in WB, ELISA applications with reactivity to human, rat, pig samples 60966-4-Ig targets FHL3 in WB, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: HUVEC cells, Mo7e cells, pig skeletal muscle tissue, HeLa cells, K-562 cells, Kasumi-1 cells, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Four and a half LIM domain (FHL) protein 3 is a member of the FHL protein family that has roles in the regulation of signal transduction, survival, cell adhesion, and mobility. It also involves in the development and progression of liver cancer. The FHL proteins have been shown to regulate a variety of transcription factors, including SMAD proteins, β-catenin, SRF, AP-1, NFAT, FOXO1, MyoD, and the androgen receptor. Beside, the FHL proteins may involve in muscle growth and differentiation. Recent research revealed FHL3 was a PCBP2 target, also involved in the growth and induced apoptosis of glioma cell (23585479). Specification Tested Reactivity: human, rat, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1495 Product name: Recombinant human FHL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC011697 Sequence: MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP Predict reactive species Full Name: four and a half LIM domains 3 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC011697 Gene Symbol: FHL3 Gene ID (NCBI): 2275 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13643 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924