Iright
BRAND / VENDOR: Proteintech

Proteintech, 66025-1-Ig, EIF3M Monoclonal antibody

CATALOG NUMBER: 66025-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF3M (66025-1-Ig) by Proteintech is a Monoclonal antibody targeting EIF3M in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66025-1-Ig targets EIF3M in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells Positive IHC detected in: human colon cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information EIF3M gene encodes eukaryotic translation initiation factor (eIF) subunit M, also called GA17 or PCID1. eIF-3 complex is required for several steps in the initiation of protein synthesis, and recent studies indicate that regulation of oncogene expression and neoplastic transformation are controlled by eIF subunits. The most uncharacterized non-core subunit EIF3M was confirmed to be highly expressed in human cancer cell lines and colon cancer patient tissues and mediate regulation of tumorigenesis-related genes in human colon cancer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17965 Product name: Recombinant human EIF3M protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-374 aa of BC019103 Sequence: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit M Calculated Molecular Weight: 374 aa, 43 kDa Observed Molecular Weight: 35-43 kDa GenBank Accession Number: BC019103 Gene Symbol: EIF3M Gene ID (NCBI): 10480 RRID: AB_11042448 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7L2H7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924