Iright
BRAND / VENDOR: Proteintech

Proteintech, 66028-1-Ig, RNH1 Monoclonal antibody

CATALOG NUMBER: 66028-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RNH1 (66028-1-Ig) by Proteintech is a Monoclonal antibody targeting RNH1 in WB, ELISA applications with reactivity to human samples 66028-1-Ig targets RNH1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Ribonuclease/ angiogenin inhibitor (RNH, synonyms: RAI, MGC4569, MGC18200, MGC54054) is a protein that binds tightly to ribonucleases in cells and may be essential in the control of mRNA degradation and gene expression. The human RNH gene has been regionally localized to chromosome band 11p15 by in situ hybridization. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18093 Product name: Recombinant human RNH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-214 aa of BC000677 Sequence: MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVHVLCQGLKDSPCQLEALKLESCGVTSD Predict reactive species Full Name: ribonuclease/angiogenin inhibitor 1 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC000677 Gene Symbol: RNH1 Gene ID (NCBI): 6050 RRID: AB_11043338 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P13489 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924