Iright
BRAND / VENDOR: Proteintech

Proteintech, 66039-3-Ig, CPT1A Monoclonal antibody

CATALOG NUMBER: 66039-3-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CPT1A (66039-3-Ig) by Proteintech is a Monoclonal antibody targeting CPT1A in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 66039-3-Ig targets CPT1A in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: TT cells, HeLa cells, rat liver tissue, mouse liver tissue, LNCaP cells, PANC-1 cells, HaCaT cells Positive IP detected in: MCF-7 cells, HepG2 cells Positive IHC detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CPT1A, also named as CPT1, CPT1-L and L-CPTI, belongs to the carnitine/choline acetyltransferase family. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CPT1A is an active forms of related liver-type carnitine palmitoyltransferase I. (PMID: 11001805). CPT1A deficiency presents as recurrent attacks of fasting hypoketotic hypoglycemia. (PMID: 15363638). This antibody can bind the close sequences genes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7745 Product name: Recombinant human CPT1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 406-756 aa of BC000185 Sequence: QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETGIISQGPSSDT Predict reactive species Full Name: carnitine palmitoyltransferase 1A (liver) Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: BC000185 Gene Symbol: CPT1A Gene ID (NCBI): 1374 RRID: AB_3670374 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P50416 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924