Iright
BRAND / VENDOR: Proteintech

Proteintech, 66042-1-Ig, Fibronectin Monoclonal antibody

CATALOG NUMBER: 66042-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Fibronectin (66042-1-Ig) by Proteintech is a Monoclonal antibody targeting Fibronectin in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 66042-1-Ig targets Fibronectin in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human plasma tissue, human plasma, rat serum, HuH-7 cells, HepG2 cells, MG-63 cells, U2OS cells Positive IP detected in: human plasma tissue Positive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon cancer tissue Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Fibronectin 1 (FN1) is a high molecular weight glycoprotein which exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1). Plasma FN1 (dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. FN1 binds to cell surfaces through integrins and to various compounds including collagen, fibrin and heparin. It is involved in cell adhesion and migration processes including embryogenesis, wound healing, hemostasis, host defense, and metastasis. (PMID: 7276612; 12244123; 12847088) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, canine, sheep Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8016 Product name: Recombinant human FN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2177-2386 aa of BC005858 Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE Predict reactive species Full Name: fibronectin 1 Calculated Molecular Weight: 2386 aa, 263 kDa Observed Molecular Weight: 263 kDa GenBank Accession Number: BC005858 Gene Symbol: Fibronectin Gene ID (NCBI): 2335 RRID: AB_11182385 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02751 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924