Iright
BRAND / VENDOR: Proteintech

Proteintech, 66054-1-Ig, ARHGDIB Monoclonal antibody

CATALOG NUMBER: 66054-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARHGDIB (66054-1-Ig) by Proteintech is a Monoclonal antibody targeting ARHGDIB in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 66054-1-Ig targets ARHGDIB in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: THP-1 cells, Jurkat cells, U-937 cells, HL-60 cells, Raji cells Positive IHC detected in: human tonsillitis tissue, human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:10000-1:50000 Immunohistochemistry (IHC): IHC : 1:5000-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information ARHGDIB, also known as RhoGDI2, is a conserved member of the RhoGDI family and plays an important role in cell migrations. It regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. It is mainly in hematopoietic, endothelial, and epithelial cells. It has been linked to tumorigenesis and metastasis. RhoGDI2 expression is downregulated in several cancer types, such as bladder, lung and lymphoma, but is upregulated in prostate and gastric cancer. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9091 Product name: Recombinant human ARHGDIB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC009200 Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE Predict reactive species Full Name: Rho GDP dissociation inhibitor (GDI) beta Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC009200 Gene Symbol: ARHGDIB Gene ID (NCBI): 397 RRID: AB_11045657 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P52566 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924