Iright
BRAND / VENDOR: Proteintech

Proteintech, 66067-1-Ig, Caveolin-1 Monoclonal antibody

CATALOG NUMBER: 66067-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Caveolin-1 (66067-1-Ig) by Proteintech is a Monoclonal antibody targeting Caveolin-1 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 66067-1-Ig targets Caveolin-1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, A431 cells, PC-3 cells, human heart tissue, pig heart tissue, Rat heart tissue, mouse heart tissue Positive IHC detected in: human ovary tumor tissue, human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue, mouse kidney tissue, human skin cancer tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric Cancer (PMID: 25339030). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, canine, monkey, chicken, sheep Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species Full Name: caveolin 1, caveolae protein, 22kDa Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC006432 Gene Symbol: CAV1 Gene ID (NCBI): 857 RRID: AB_11043343 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q03135 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924