Iright
BRAND / VENDOR: Proteintech

Proteintech, 66068-1-Ig, SRP9 Monoclonal antibody

CATALOG NUMBER: 66068-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SRP9 (66068-1-Ig) by Proteintech is a Monoclonal antibody targeting SRP9 in WB, ELISA applications with reactivity to human, rat, mouse samples 66068-1-Ig targets SRP9 in WB, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: HSC-T6 cells, HeLa cells, HEK-293 cells, ROS1728 cells, NIH/3T3 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Signal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein. Specification Tested Reactivity: human, rat, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17153 Product name: Recombinant human SRP9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-86 aa of BC015094 Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE Predict reactive species Full Name: signal recognition particle 9kDa Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC015094 Gene Symbol: SRP9 Gene ID (NCBI): 6726 RRID: AB_11042618 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49458 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924