Iright
BRAND / VENDOR: Proteintech

Proteintech, 66077-1-Ig, TELO2 Monoclonal antibody

CATALOG NUMBER: 66077-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TELO2 (66077-1-Ig) by Proteintech is a Monoclonal antibody targeting TELO2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 66077-1-Ig targets TELO2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: Y79 cells, L02 cells, A431 cells, HeLa cells, HEK-293 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human kidney tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information TELO2 gene encodes a telomere length regulation protein TEL2 homolog. TELO2 may be involved in telomere length regulation and can form TTT complex with TTI1 and TTI2. TTT complex is required to stabilize protein levels of PIKK family proteins and is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), and ultraviolet (UV). The activity of mTORC1 and mTORC2 complexes, which regulate cell growth and survival in response to nutrient and hormonal signals, can be promoted, stabilized and maintained by TELO2. Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8834 Product name: Recombinant human TELO2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 488-837 aa of BC017188 Sequence: DLDSDDEFVPYDMSGDRELKSSKAPAYVRDCVEALTTSEDIERWEAALRALEGLVYRSPTATREVSVELAKVLLHLEEKTCVVGFAGLRQRALVAVTVTDPAPVADYLTSQFYALNYSLRQRMDILDVLTLAAQELSRPGCLGRTPQPGSPSPNTPCLPEAAVSQPGSAVASDWRVVVEERIRSKTQRLSKGGPRQGPAGSPSRFNSVAGHFFFPLLQRFDRPLVTFDLLGEDQLVLGRLAHTLGALMCLAVNTTVAVAMGKALLEFVWALRFHIDAYVRQGLLSAVSSVLLSLPAARLLEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPASP Predict reactive species Full Name: TEL2, telomere maintenance 2, homolog (S. cerevisiae) Calculated Molecular Weight: 837 aa, 92 kDa Observed Molecular Weight: 92 kDa GenBank Accession Number: BC017188 Gene Symbol: TELO2 Gene ID (NCBI): 9894 RRID: AB_11182835 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y4R8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924