Iright
BRAND / VENDOR: Proteintech

Proteintech, 66103-1-Ig, CD22 Monoclonal antibody

CATALOG NUMBER: 66103-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD22 (66103-1-Ig) by Proteintech is a Monoclonal antibody targeting CD22 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 66103-1-Ig targets CD22 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Ramos cells, Raji cells, Daudi cells Positive IHC detected in: human tonsillitis tissue, human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue, Raji cells Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:2500-1:10000 Immunohistochemistry (IHC): IHC : 1:10000-1:40000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CD22, also known as Siglec-2 (sialic acid binding Ig-like lectin 2) or BL-CAM (B-lymphocyte cell adhesion molecule), is a 130-140 kDa, B-cell restricted, type I transmembrane glycoprotein belonging to the immunoglobulin gene superfamily. The expression of CD22 is developmentally regulated. It is expressed at low levels in the cytoplasm of pro-B and pre-B cells and present on the cell surface only at mature stages of B-cell differentiation. Cell surface expression is lost during terminal differentiation into plasma cell and after B-cell activation. CD22 is an inhibitory receptor for B-cell receptor (BCR) signalling, preferentially binds to alpha-2,6-linked sialic acid and mediates B-cell B-cell interactions. It plays a crucial role in activation and differentiation of the B-cell. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17986 Product name: Recombinant human CD22 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 166-515 aa of BC109306 Sequence: ILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR Predict reactive species Full Name: CD22 molecule Calculated Molecular Weight: 847 aa, 95 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC109306 Gene Symbol: CD22 Gene ID (NCBI): 933 RRID: AB_2881502 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20273 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924