Iright
BRAND / VENDOR: Proteintech

Proteintech, 66106-1-Ig, SULT4A1 Monoclonal antibody

CATALOG NUMBER: 66106-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SULT4A1 (66106-1-Ig) by Proteintech is a Monoclonal antibody targeting SULT4A1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 66106-1-Ig targets SULT4A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Human brain, tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information SULT4A1, also named as SULTX3, NST, ST4A1, hBR-STL and hBR-STL-1, belongs to the sulfotransferase 1 family. It may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. SULT4A1 displays activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphtylamine, and 2-naphtol. It may have a role in the sulfation of drugs and neurotransmitters in the CNS. SULT4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. It is a novel cytosolic sulfotransferase that is primarily expressed in the brain. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17962 Product name: Recombinant human SULT4A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-284 aa of BC022459 Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL Predict reactive species Full Name: sulfotransferase family 4A, member 1 Calculated Molecular Weight: 284 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC022459 Gene Symbol: SULT4A1 Gene ID (NCBI): 25830 RRID: AB_2881505 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BR01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924