Proteintech, 66111-1-Ig, SNRPD2 Monoclonal antibody

Size: 20ul / 150ul The SNRPD2 (66111-1-Ig) by Proteintech is a Monoclonal antibody targeting SNRPD2 in WB, ELISA applications with reactivity to human samples 66111-1-Ig targets SNRPD2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Hela cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Systemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD2 is one of Sm protein, and is required for pre-mRNA splicing, snRNP biogenesis. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7115 Product name: Recombinant human SNRPD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-118 aa of BC000486 Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK Predict reactive species Full Name: small nuclear ribonucleoprotein D2 polypeptide 16.5kDa Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14-16 kDa GenBank Accession Number: BC000486 Gene Symbol: SNRPD2 Gene ID (NCBI): 6633 RRID: AB_2881510 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P62316 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.