Proteintech, 66129-1-Ig, Arginase-1 Monoclonal antibody

Size: 20ul / 150ul The Arginase-1 (66129-1-Ig) by Proteintech is a Monoclonal antibody targeting Arginase-1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 66129-1-Ig targets Arginase-1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig liver tissue, rat liver tissue, mouse liver tissue, rabbit liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: mouse liver tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Positive IF/ICC detected in: HepG2 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:5000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Arginase-1 (Liver arginase) belongs to the arginase family. ARG1 is a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology and a marker of hepatocytes and hepatocellular neoplasms. ARG1 is closely associated with alternative macrophage activation and ARG1 has been shown to protectmotor neurons from trophic factor deprivation and allow sensory neurons to overcome neurite outgrowth inhibition by myelin proteins (PMID: 20071539, PMID:12098359). It can exsit as a homotrimer and it has 3 isoforms produced by alternative splicing (PMID:16141327). Defects in ARG1 are the cause of argininemia (ARGIN). Deletion or TNF-mediated restriction of ARG1 unleashes the production of NO by NOS2, which is critical for pathogen control (PMID:27117406). Before stroke, ARG1 mainly expressed in neurons in a normal brain (PMID: 23311438). The expression of ARG1 increases in microglia/macrophages and astrocytes early after CNS injuries. ARG1 has been regarded as a marker for beneficial microglia/macrophages and possesses antiinflammatory and tissue repair properties under various pathological conditions (PMID: 26538310, PMID: 31619589). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8810 Product name: Recombinant human ARG1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-236 aa of BC005321 Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK Predict reactive species Full Name: arginase, liver Calculated Molecular Weight: 236aa,25 kDa; 322aa,35 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC005321 Gene Symbol: Arginase-1 Gene ID (NCBI): 383 RRID: AB_2881528 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P05089 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.