Proteintech, 66134-1-Ig, GOSR2/Membrin Monoclonal antibody

Size: 20ul / 150ul The GOSR2/Membrin (66134-1-Ig) by Proteintech is a Monoclonal antibody targeting GOSR2/Membrin in WB, IHC, IF-P, ELISA applications with reactivity to human, rat samples 66134-1-Ig targets GOSR2/Membrin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, Jurkat cells, PC-12 cells, HEK-293 cells, HepG2 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Golgi SNAP receptor complex member 2 (GOSR2), also known as GS27 or Membrin, is a member of the solube NSF attachment protein receptor (SNARE) family of vesicle docking proteins. GOSR2 is localized in Golgi apparatus. It is involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network. Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21393 Product name: Recombinant human GOSR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-192 aa of BC009710 Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF Predict reactive species Full Name: golgi SNAP receptor complex member 2 Calculated Molecular Weight: 212 aa, 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC009710 Gene Symbol: Membrin Gene ID (NCBI): 9570 RRID: AB_2881533 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14653 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.