Iright
BRAND / VENDOR: Proteintech

Proteintech, 66140-1-Ig, C9orf72 Monoclonal antibody

CATALOG NUMBER: 66140-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C9orf72 (66140-1-Ig) by Proteintech is a Monoclonal antibody targeting C9orf72 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 66140-1-Ig targets C9orf72 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, C6 cells, Neuro-2a cells Positive IP detected in: C6 cells Positive IHC detected in: human gliomas tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). FTLD-TDP has five subtypes: Sporadic FTLD, GRN mutation FTLD, TARDBP mutation FTLD, VCP mutation FTLD and C9ORF72 mutation FTLD. The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21080 Product name: Recombinant human C9orf72 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-169 aa of BC020851 Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG Predict reactive species Full Name: chromosome 9 open reading frame 72 Calculated Molecular Weight: 481 aa, 54 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC020851 Gene Symbol: C9orf72 Gene ID (NCBI): 203228 RRID: AB_2784547 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96LT7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924