Iright
BRAND / VENDOR: Proteintech

Proteintech, 66159-1-Ig, NAPRT1 Monoclonal antibody

CATALOG NUMBER: 66159-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NAPRT1 (66159-1-Ig) by Proteintech is a Monoclonal antibody targeting NAPRT1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 66159-1-Ig targets NAPRT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: THP-1 cells, HEK-293 cells, Jurkat cells, HepG2 cells, LNCaP cells, HeLa cells, K-562 cells Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:100-1:500 Background Information Nicotinic acid (NA) is a coenzyme in cellular redox reactions, and is an essential component of metabolic pathways in all living cells. NAPRT1 (Nicotinate phosphoribosyltransferase) is essential for increasing cellular NAD levels and, thus, to prevent oxidative stress of cells. NAPRT1 converts Nicotinic acid (NA; niacin) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4265 Product name: Recombinant human NAPRT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-310 aa of BC032466 Sequence: MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP Predict reactive species Full Name: nicotinate phosphoribosyltransferase domain containing 1 Calculated Molecular Weight: 514 aa, 55 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC032466 Gene Symbol: NAPRT1 Gene ID (NCBI): 93100 RRID: AB_2881555 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6XQN6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924