Proteintech, 66161-1-Ig, BMI1 Monoclonal antibody

Size: 20ul / 150ul The BMI1 (66161-1-Ig) by Proteintech is a Monoclonal antibody targeting BMI1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, monkey samples 66161-1-Ig targets BMI1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: PC-12 cells, HT-1080 cells, U2OS cells, U-937 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissue, human colon cancer, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells, COS-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information BMI- 1 is one of polycomb group genes, which together with Ring1 strongly enhances the E3 ubiquitin ligase activity of the Ring2 catalytic subunit. Bmi1 plays an important role in the regulation of cell proliferation and senescence through repression of the p16Ink4a and p19Arf genes and is required for maintenance of adult hematopoietic and neural stem cells. The antibody reacts with the 37kd BMI1 protein. Specification Tested Reactivity: human, mouse, monkey Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21284 Product name: Recombinant human BMI1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-326 aa of BC011652 Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG Predict reactive species Full Name: BMI1 polycomb ring finger oncogene Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 37-43 kDa GenBank Accession Number: BC011652 Gene Symbol: BMI1 Gene ID (NCBI): 648 RRID: AB_2881557 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35226 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.