Iright
BRAND / VENDOR: Proteintech

Proteintech, 66167-1-Ig, Claudin 18 Monoclonal antibody

CATALOG NUMBER: 66167-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Claudin 18 (66167-1-Ig) by Proteintech is a Monoclonal antibody targeting Claudin 18 in IHC, IP, ELISA applications with reactivity to human, mouse samples 66167-1-Ig targets Claudin 18 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse stomach tissue Positive IHC detected in: human pancreas cancer tissue, human ovary tumor tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Claudin 18 (CLDN18) belongs to the large claudin family of proteins, which are tetraspan transmembrane proteins of tight junctions (PMID: 11585919; 18036336). Claudins exhibit specific patterns of expression in different tissues (PMID: 15447685). CLDN18 is specifically expressed in the stomach and lung. CLDN18 has two alternatively spliced variants, CLDN18.1 and CLDN18.2. CLDN18.2 is a highly selective gastric lineage marker that determines the gastric phenotype in a neoplastic condition, whereas CLDN18.1 is lung specific (PMID: 11585919; 21832145). Altered CLDN18 expression has been reported in various human malignancies, including gastric cancer, lung adenocarcinoma, and pancreatic neoplasm (PMID: 17459057; 22076167; 21832145). This antibody can recognize both CLDN18.1 and CLDN18.2. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15517 Product name: Recombinant human CLDN18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-261 aa of BC146668 Sequence: TLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV Predict reactive species Full Name: claudin 18 Calculated Molecular Weight: 261 aa, 28 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC146668 Gene Symbol: CLDN18 Gene ID (NCBI): 51208 RRID: AB_2881563 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56856 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924