Iright
BRAND / VENDOR: Proteintech

Proteintech, 66191-1-Ig, VAPB Monoclonal antibody

CATALOG NUMBER: 66191-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VAPB (66191-1-Ig) by Proteintech is a Monoclonal antibody targeting VAPB in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66191-1-Ig targets VAPB in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, LNCaP cells, MCF-7 cells, HeLa cells, Jurkat cells, K-562 cells Positive IHC detected in: human breast cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Vesicle-associated membrane protein-associated protein B (VAPB) is an integral membrane protein localized to the endoplasmic reticulum (ER) membrane. VAPB has been implicated in various cellular processes, including ER stress, the unfolded protein response (UPR) and calcium homeostasis regulation. The mutations in the gene of VAPB cause amyotrophic lateral sclerosis 8 (ALS8) and some other related forms of motor neuron disease including late onset spinal muscular atrophy. Specification Tested Reactivity: human Cited Reactivity: human, mouse, monkey, yeast Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6313 Product name: Recombinant human VAPB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-180 aa of BC001712 Sequence: KLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV Predict reactive species Full Name: VAMP (vesicle-associated membrane protein)-associated protein B and C Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC001712 Gene Symbol: VAPB Gene ID (NCBI): 9217 RRID: AB_2881586 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O95292 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924