Proteintech, 66215-1-Ig, APOD Monoclonal antibody

Size: 20ul / 150ul The APOD (66215-1-Ig) by Proteintech is a Monoclonal antibody targeting APOD in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66215-1-Ig targets APOD in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue, human plasma, human urine sample, human placenta tissue Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Apolipoprotein D (ApoD) is a member of the lipocalin superfamily of ligand transporters, and has been implicated in the transport of small hydrophobic molecules. ApoD is also a component of plasma high-density lipoproteins (HDL). Alteration of ApoD expression has been linked to multiple neurological disorders, including Alzheimer's disease. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21422 Product name: Recombinant human APOD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 15-189 aa of BC007402 Sequence: FGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS Predict reactive species Full Name: apolipoprotein D Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC007402 Gene Symbol: APOD Gene ID (NCBI): 347 RRID: AB_2881606 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P05090 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.