Iright
BRAND / VENDOR: Proteintech

Proteintech, 66216-1-Ig, TLE1 Monoclonal antibody

CATALOG NUMBER: 66216-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TLE1 (66216-1-Ig) by Proteintech is a Monoclonal antibody targeting TLE1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66216-1-Ig targets TLE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells Positive IHC detected in: human gliomas tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information TLE1 (Transducin-like enhancer protein 1) is a transcriptional corepressor and binds to a number of transcription factors. It can inhibit NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (PMID: 10660609). TLE1 is highly expressed in postnatal brain (PMID: 29758293; 27852056). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21327 Product name: Recombinant human TLE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 422-770 aa of BC010100 Sequence: DPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY Predict reactive species Full Name: transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 85-95 kDa GenBank Accession Number: BC010100 Gene Symbol: TLE1 Gene ID (NCBI): 7088 RRID: AB_2881607 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04724 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924