Proteintech, 66237-1-Ig, Mammaglobin A Monoclonal antibody

Size: 20ul / 150ul The Mammaglobin A (66237-1-Ig) by Proteintech is a Monoclonal antibody targeting Mammaglobin A in IHC, IF-P, ELISA applications with reactivity to human samples 66237-1-Ig targets Mammaglobin A in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Mammaglobin A, also known as SCGB2A2, is a member of the secretoglobin superfamily. Mammaglobin A is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. This monoclonal antibody is raised against full-length of 93-amino acid human mammaglobin A. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag22485 Product name: Recombinant human SCGB2A2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-93 aa of BC128252 Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF Predict reactive species Full Name: secretoglobin, family 2A, member 2 Calculated Molecular Weight: 93 aa, 10 kDa GenBank Accession Number: BC128252 Gene Symbol: Mammaglobin A Gene ID (NCBI): 4250 RRID: AB_2881626 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13296 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.