Iright
BRAND / VENDOR: Proteintech

Proteintech, 66246-1-Ig, BBS2 Monoclonal antibody

CATALOG NUMBER: 66246-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BBS2 (66246-1-Ig) by Proteintech is a Monoclonal antibody targeting BBS2 in WB, IF/ICC, ELISA applications with reactivity to human, Canine samples 66246-1-Ig targets BBS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, Canine samples. Tested Applications Positive WB detected in: K-562 cells Positive IF/ICC detected in: MDCK cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, Canine Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG3 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21390 Product name: Recombinant human BBS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-325 aa of BC014140 Sequence: MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANVVVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMR Predict reactive species Full Name: Bardet-Biedl syndrome 2 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC014140 Gene Symbol: BBS2 Gene ID (NCBI): 583 RRID: AB_2881635 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BXC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924