Iright
BRAND / VENDOR: Proteintech

Proteintech, 66270-1-Ig, CLTB Monoclonal antibody

CATALOG NUMBER: 66270-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CLTB (66270-1-Ig) by Proteintech is a Monoclonal antibody targeting CLTB in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig samples 66270-1-Ig targets CLTB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig brain tissue Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (180 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The light chain subunits are thought to regulate the formation or disassembly of clathrin coats. (PMID: 2445759; 8374173; 3563513) Specification Tested Reactivity: human, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24347 Product name: Recombinant human CLTB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-211 aa of BC006457 Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR Predict reactive species Full Name: clathrin, light chain (Lcb) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 32-38 kDa GenBank Accession Number: BC006457 Gene Symbol: CLTB Gene ID (NCBI): 1212 RRID: AB_2881655 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P09497 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924