Proteintech, 66290-1-Ig, GLUT1 Monoclonal antibody

Size: 20ul / 150ul The GLUT1 (66290-1-Ig) by Proteintech is a Monoclonal antibody targeting GLUT1 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human samples 66290-1-Ig targets GLUT1 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human lung cancer tissue, human rectal cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human lung cancer tissue, human placenta tissue Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Glucose transporter 1 (GLUT1), also known as solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), is a uniporter protein responsible for the transport of glucose in many cell types and across the blood-brain barrier.What is the molecular weight of GLUT1? Is GLUT1 post-translationally modified?There are two forms of GLUT1 transporter that differ in their molecular weight. The 45-kDa form is found in glial cells, while the 55-kDa form is present in the endothelial cells regulating glucose transport over the blood-brain and blood-tissue barriers (PMID: 9630522). N-glycosylation of asparagine at position 42 is the only known post-translation modification of GLUT1 (PMID: 3839598).What is the subcellular localization of GLUT1?Glucose transporters, including GLUT1, are multiple-pass integral membrane proteins. GLUT1 is present at the plasma membrane but is also a subject of recycling between plasma membrane and endosomes.What molecules can be transported by GLUT1?The main substrate of GLUT1 transport is glucose, but it can also transport galactose, mannose, glucosamine, and reduced ascorbate.What is the tissue expression pattern of GLUT1?GLUT1 is expressed by many cell types but the highest levels are observed in erythrocytes and in the central nervous system (astrocytes). GLUT1 is responsible for glucose transfer across the blood-brain and blood-tissue barriers, including placental transport. Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17108 Product name: Recombinant human SLC2A1,GLUT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 216-280 aa of BC121804 Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 1 Calculated Molecular Weight: 492 aa, 54 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC121804 Gene Symbol: GLUT1 Gene ID (NCBI): 6513 RRID: AB_2881673 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P11166 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.