Iright
BRAND / VENDOR: Proteintech

Proteintech, 66302-1-Ig, CHCHD2 Monoclonal antibody

CATALOG NUMBER: 66302-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul CHCHD2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA 66302-1-Ig targets CHCHD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, rat liver tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, L02 cells, SMMC-7721 cells, pig liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:1500-1:6000 Background Information CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741). Specification Tested Reactivity: human, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24219 Product name: Recombinant human CHCHD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-151 aa of BC003079 Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA Predict reactive species Full Name: coiled-coil-helix-coiled-coil-helix domain containing 2 Calculated Molecular Weight: 151 aa, 16 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC003079 Gene Symbol: CHCHD2 Gene ID (NCBI): 51142 RRID: AB_2881685 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y6H1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924