Proteintech, 66316-1-Ig, EPCAM/CD326 Monoclonal antibody

Size: 20ul / 150ul The EPCAM/CD326 (66316-1-Ig) by Proteintech is a Monoclonal antibody targeting EPCAM/CD326 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 66316-1-Ig targets EPCAM/CD326 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells, A431 cells, T-47D cells, MCF-7 cells Positive IHC detected in: Human colon tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon cancer tissue, human stomach cancer tissue Positive IF/ICC detected in: MCF-7 cells, HT-29 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15393 Product name: Recombinant human EPCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-264 aa of BC014785 Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGL Predict reactive species Full Name: epithelial cell adhesion molecule Calculated Molecular Weight: 314 aa, 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC014785 Gene Symbol: EPCAM Gene ID (NCBI): 4072 RRID: AB_2881697 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P16422 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.