Iright
BRAND / VENDOR: Proteintech

Proteintech, 66322-1-Ig, GAMT Monoclonal antibody

CATALOG NUMBER: 66322-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GAMT (66322-1-Ig) by Proteintech is a Monoclonal antibody targeting GAMT in WB, ELISA applications with reactivity to human, rat, mouse, pig samples 66322-1-Ig targets GAMT in WB, ELISA applications and shows reactivity with human, rat, mouse, pig samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse liver tissue, pig liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information GAMT converts the latter to creatine with S-adenosylmethionine as the methyl donor. GAMT was induced in human and mouse cells in response to genotoxic and metabolic stress. GAMT was required for p53-dependent upregulation of creatine biosynthesis, fatty acid oxidation, and apoptosis in response to glucose deprivation. Specification Tested Reactivity: human, rat, mouse, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16778 Product name: Recombinant human GAMT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-236 aa of BC016760 Sequence: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG Predict reactive species Full Name: guanidinoacetate N-methyltransferase Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC016760 Gene Symbol: GAMT Gene ID (NCBI): 2593 RRID: AB_2881702 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14353 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924