Proteintech, 66354-1-Ig, EBI3/IL-27B Monoclonal antibody

Size: 20ul / 150ul The EBI3/IL-27B (66354-1-Ig) by Proteintech is a Monoclonal antibody targeting EBI3/IL-27B in WB, ELISA applications with reactivity to human, rat, pig samples 66354-1-Ig targets EBI3/IL-27B in WB, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: human spleen tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information EBI3, a 34-kDa secreted glycoprotein, is a subunit in 2 distinct heterodimeric cytokines: IL-27 and IL-35. IL-27, composed of p28 (IL-27) and EBI3, can trigger signaling in T cells, B cells, and myeloid cells. IL-35, composed of EBI3 and the ubiquitously expressed p35 subunit of IL-12, is an inhibitory cytokine involved in regulatory T-cell function. EBI3 plays a role in regulating cell-mediated immune responses. (PMID: 8551575; 18033300; 17874423; 21931777) Specification Tested Reactivity: human, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3051 Product name: Recombinant human EBI3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC015364 Sequence: MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK Predict reactive species Full Name: Epstein-Barr virus induced 3 Calculated Molecular Weight: 229 aa, 25 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC015364 Gene Symbol: EBI3 Gene ID (NCBI): 10148 RRID: AB_2881734 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14213 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.