Iright
BRAND / VENDOR: Proteintech

Proteintech, 66364-1-Ig, D2HGDH Monoclonal antibody

CATALOG NUMBER: 66364-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The D2HGDH (66364-1-Ig) by Proteintech is a Monoclonal antibody targeting D2HGDH in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66364-1-Ig targets D2HGDH in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, C6 cells, rat heart tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information D2HGDH(D-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as D2HGD and belongs to the FAD-binding oxidoreductase/transferase type 4 family.It catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate.Defects in D2HGDH are the cause of D-2-hydroxyglutaric aciduria type 1 (D2HGA1). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5036 Product name: Recombinant human D2HGDH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-286 aa of BC036604 Sequence: MLPRRPLAWPAWLLRGAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVQRLPFSTVSKQDLAAFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGC Predict reactive species Full Name: D-2-hydroxyglutarate dehydrogenase Calculated Molecular Weight: 521 aa, 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC036604 Gene Symbol: D2HGDH Gene ID (NCBI): 728294 RRID: AB_2881744 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8N465 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924