Iright
BRAND / VENDOR: Proteintech

Proteintech, 66395-1-Ig, CD36 Monoclonal antibody

CATALOG NUMBER: 66395-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD36 (66395-1-Ig) by Proteintech is a Monoclonal antibody targeting CD36 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 66395-1-Ig targets CD36 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human heart tissue, human milk, human spleen tissue, human placenta tissue Positive IHC detected in: human spleen tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue, THP-1 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information FunctionCD36, also known as platelet glycoprotein 4, is an integral membrane glycoprotein that acts as a scavenger receptor. CD36 can bind to multiple ligands, including thrombospondin-1, collagen, oxidized phospholipids, oxidized low-density lipoprotein, and long-chain fatty acids. CD36 can also bind to erythrocytes parasitized by Plasmodium falciparum and apoptotic cells. CD36 mediates different biological processes, acting as a signaling hub in angiogenesis, inflammatory response, and fatty acid metabolism.Tissue specificityCD36 is present on the surface of various cells types, such as adipocytes, monocytes, macrophages, platelets, microvascular endothelial cells, dendritic cells, and hematopoietic precursors of red cells.Involvement in diseaseMutations in CD36 can give rise to platelet glycoprotein IV deficiency, a type of macrothrombocytopenia.Polymorphisms in CD36 can increase susceptibility to malaria.AAGIC haplotype at the CD36 locus increases the risk of coronary heart disease.Disruption of CD36-dependent pathways and certain SNPs in the CD36 gene are attributed to impaired fatty acid metabolism, glucose intolerance, Alzheimer's disease, atherosclerosis, arterial hypertension, diabetes, and cardiomyopathy.IsoformsApart from the full-length protein (isoform 1), one additional shorter isoform has been reported (PMID: 7509795). Other alternative isoforms have also been detected on the mRNA level (PMID: 17673938).Post-translational modificationsThe extracellular domain of CD36 is extensively glycosylated. Glycosylation is needed for the transport of CD36 to the plasma membrane, as well as mediating recognition and binding to ligands. Cytoplasmic tails of transmembrane domains can be phosphorylated and play a role in signal transduction. Intracellular domains can be additionally acetylated, ubiquitinated, and palmitoylated (PMID: 28919632).Cellular localizationCD36 is present on the cell surface. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13541 Product name: Recombinant human CD36 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-472 aa of BC008406 Sequence: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK Predict reactive species Full Name: CD36 molecule (thrombospondin receptor) Calculated Molecular Weight: 472 aa, 53 kDa Observed Molecular Weight: 88 kDa GenBank Accession Number: BC008406 Gene Symbol: CD36 Gene ID (NCBI): 948 RRID: AB_2811030 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P16671 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924