Proteintech, 66398-1-Ig, Vitronectin/S-protein Monoclonal antibody

Size: 20ul / 150ul The Vitronectin/S-protein (66398-1-Ig) by Proteintech is a Monoclonal antibody targeting Vitronectin/S-protein in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, pig, rabbit samples 66398-1-Ig targets Vitronectin/S-protein in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, pig, rabbit samples. Tested Applications Positive WB detected in: human plasma tissue, pig plasma tissue, rabbit serum tissue Positive IHC detected in: human testis tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:10000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Vitronectin is a glycoprotein present in blood and in the extracellular matrix (PMID: 10399314). Vitronectin is a multifunctional glycoprotein that mediates cell-to-substrate adhesion, inhibits the cytolytic action of the terminal complement cascade in vitro and binds to several serine protease inhibitors of the serpin family (PMID: 1372588). Specification Tested Reactivity: human, mouse, pig, rabbit Cited Reactivity: human, mouse, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8443 Product name: Recombinant human VTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-478 aa of BC005046 Sequence: EVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL Predict reactive species Full Name: vitronectin Calculated Molecular Weight: 478 aa, 54 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC005046 Gene Symbol: VTN Gene ID (NCBI): 7448 RRID: AB_2881772 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P04004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.