Iright
BRAND / VENDOR: Proteintech

Proteintech, 66402-1-Ig, TPRKB Monoclonal antibody

CATALOG NUMBER: 66402-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TPRKB (66402-1-Ig) by Proteintech is a Monoclonal antibody targeting TPRKB in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66402-1-Ig targets TPRKB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, COLO 320 cells, Caco-2 cells, Jurkat cells, Raji cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information TPRKB, also named as CGI 121, belongs to the CGI121/TPRKB family. It interacts with TP53RK/PRPK and is widely expressed in all tissues. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18770 Product name: Recombinant human TPRKB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-175 aa of BC029492 Sequence: MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL Predict reactive species Full Name: TP53RK binding protein Calculated Molecular Weight: 175 aa, 20 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC029492 Gene Symbol: TPRKB Gene ID (NCBI): 51002 RRID: AB_2881776 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y3C4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924