Proteintech, 66430-1-Ig, P2RX5 Monoclonal antibody

Size: 20ul / 150ul The P2RX5 (66430-1-Ig) by Proteintech is a Monoclonal antibody targeting P2RX5 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 66430-1-Ig targets P2RX5 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, pig brain tissue, Jurkat cells, K-562 cells, rat brain tissue, mouse brain tissue Positive IF-P detected in: mouse brown adipose tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5297 Product name: Recombinant human P2RX5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 52-422 aa of BC039015 Sequence: KKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST Predict reactive species Full Name: purinergic receptor P2X, ligand-gated ion channel, 5 Calculated Molecular Weight: 422 aa, 47 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC039015 Gene Symbol: P2RX5 Gene ID (NCBI): 5026 RRID: AB_2881801 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q93086 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.