Iright
BRAND / VENDOR: Proteintech

Proteintech, 66437-1-Ig, Syntaxin 1B Monoclonal antibody

CATALOG NUMBER: 66437-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Syntaxin 1B (66437-1-Ig) by Proteintech is a Monoclonal antibody targeting Syntaxin 1B in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 66437-1-Ig targets Syntaxin 1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, rat brain tissue, fetal human brain tissue, Y79 cells, rabbit brain tissue, mouse brain tissue Positive IHC detected in: rat brain tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:40000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Syntaxins are a family of transmembrane proteins that belong to the SNARE complex (PMID: 11737951). In conjunction with other SNAREs and with the cytoplasmic NSF and SNAP proteins, syntaxins mediate vesicle fusion in diverse vesicular transport processes along the exocytic and the endocytic pathway (PMID: 11737951). Syntaxin 1A and 1B, two closely related isoforms of syntaxin 1, are involved in synaptic vesicle docking and fusion during neurotransmitter release (PMID: 7690687; 1321498; 18691641). This antibody raised against 1-263 aa of human syntaxin 1B detects a ~33 kDa band of syntaxin 1 and an additional band of 55-60 kDa, which probably represents a syntaxin 1 dimer (PMID: 10100611). This antibody may react with both Syntaxin 1B and Syntaxin 1A. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10257 Product name: Recombinant human STX1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-263 aa of BC062298 Sequence: MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK Predict reactive species Full Name: syntaxin 1B Calculated Molecular Weight: 288 aa, 33 kDa Observed Molecular Weight: 33 kDa, 55 kDa GenBank Accession Number: BC062298 Gene Symbol: STX1B Gene ID (NCBI): 112755 RRID: AB_2881807 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P61266 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924