Proteintech, 66446-1-Ig, CBX3 Monoclonal antibody

Size: 20ul / 150ul The CBX3 (66446-1-Ig) by Proteintech is a Monoclonal antibody targeting CBX3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 66446-1-Ig targets CBX3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HEK-293 cells, HeLa cells, Jurkat cells, RAW 264.7 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information The family of Heterochromatin protein 1 (HP1) proteins is a family of highly conserved heterochromatin-associated non-histone chromosomal proteins , which has important functions in nucleus. These functions include gene activation or repression, regulation of binding of cohesion complexes to centromere, sequestration of genes to nuclear periphery, and heterochromatin formation and propagation. Much evidence shows that HP1 proteins interact with numerous proteins including methylated histones, histone methyltransferases and so on. CBX3 is one of the paralogues of HP1 proteins Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19112 Product name: Recombinant human CBX3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-183 aa of BC000954 Sequence: MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ Predict reactive species Full Name: chromobox homolog 3 (HP1 gamma homolog, Drosophila) Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC000954 Gene Symbol: CBX3 Gene ID (NCBI): 11335 RRID: AB_2881815 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13185 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.