Iright
BRAND / VENDOR: Proteintech

Proteintech, 66449-1-Ig, HVCN1 Monoclonal antibody

CATALOG NUMBER: 66449-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HVCN1 (66449-1-Ig) by Proteintech is a Monoclonal antibody targeting HVCN1 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 66449-1-Ig targets HVCN1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, HeLa cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information HVCN1, also named as VSOP and HV1, Belongs to the hydrogen channel family. HVCN1 mediates the voltage-dependent proton permeability of excitable membranes. It forms a proton-selective channel through which protons may pass in accordance with their electrochemical gradient. Proton efflux, HVCN1 is accompanied by membrane depolarization, facilitates acute production of reactive oxygen species in phagocytosis. HVCN1, the voltage-sensitive proton channel, is present in human sperm and is an important regulator of the functional maturation of sperm. HVCN1 has four isoforms with MW 28-32 kDa or 40 kDa (modification). It has a dimer form with MW 60 kDa. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5350 Product name: Recombinant human HVCN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC032672 Sequence: MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQV Predict reactive species Full Name: hydrogen voltage-gated channel 1 Calculated Molecular Weight: 273 aa, 32 kDa Observed Molecular Weight: 28-35 kDa, 40 kDa, 60 kDa GenBank Accession Number: BC032672 Gene Symbol: HVCN1 Gene ID (NCBI): 84329 RRID: AB_2881818 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96D96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924