Proteintech, 66487-1-Ig, CLTC Monoclonal antibody

Size: 20ul / 150ul The CLTC (66487-1-Ig) by Proteintech is a Monoclonal antibody targeting CLTC in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 66487-1-Ig targets CLTC in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, Raji cells, rat brain tissue, Jurkat cells, ROS1728 cells, pig brain tissue, HEK-293 cells, K-562 cells, rabbit brain tissue, mouse brain tissue Positive IHC detected in: mouse kidney tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677) Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat, pig, monkey, chicken Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25040 Product name: Recombinant human CLTC protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-351 aa of BC054489 Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM Predict reactive species Full Name: clathrin, heavy chain (Hc) Calculated Molecular Weight: 192 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: BC054489 Gene Symbol: CLTC Gene ID (NCBI): 1213 RRID: AB_2881852 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q00610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.