Proteintech, 66494-1-Ig, NR2E3 Monoclonal antibody

Size: 20ul / 150ul The NR2E3 (66494-1-Ig) by Proteintech is a Monoclonal antibody targeting NR2E3 in WB, ELISA applications with reactivity to Pig, Mouse samples 66494-1-Ig targets NR2E3 in WB, ELISA applications and shows reactivity with Pig, Mouse samples. Tested Applications Positive WB detected in: pig retina tissue, mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NR2E3, also known as PNR, encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. NR2E3 influences the development of photoreceptors and their differentiation into rod and cone types, and acts as a ranscriptional factor that is an activator of rod development and repressor of cone development [PMID:20725840]. It binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. [PMID:15689355] Specification Tested Reactivity: Pig, Mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5831 Product name: Recombinant human NR2E3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-322 aa of BC041421 Sequence: MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN Predict reactive species Full Name: nuclear receptor subfamily 2, group E, member 3 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC041421 Gene Symbol: NR2E3 Gene ID (NCBI): 10002 RRID: AB_2881859 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y5X4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.