Proteintech, 66499-1-Ig, TAU Monoclonal antibody

Size: 20ul / 150ul The TAU (66499-1-Ig) by Proteintech is a Monoclonal antibody targeting TAU in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 66499-1-Ig targets TAU in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, Y79 cells, pig brain tissue, SH-SY5Y cells, U-251 cells, Neuro-2a cells, rat brain tissue, mouse brain tissue Positive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:30000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information The microtubule-associated protein TAU (MAPT or TAU) is encoded by MAPT gene, which locates on human chromosome 17q21, binds to the tubulin subunit of microtubule and promotes its assembly and stability. Most TAU is expressed in neurons, and TAU isoform is expressed in the peripheral nervous system while the others are expressed in the central nervous system. TAU links axonal microtubules with C-terminus to neural plasma membrane components with its N-terminus, suggesting the participation in intracellular signal transduction and neuron's development and viability. Various isoforms of Tau exist due to the alternative splicing, and short isoforms around 45-69 kDa and long isoforms around 100-110 kDa have been reported in different literature (PMID:8752131,15965697, 12485403).Present monoclonal anti-Tau antibody can detect approx 100-kDa bands in brain tissues. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG2c Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21926 Product name: Recombinant human TAU protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 5-208 aa of BC000558 Sequence: PRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENL Predict reactive species Full Name: microtubule-associated protein tau Calculated Molecular Weight: 37-46, 79-81 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC000558 Gene Symbol: TAU Gene ID (NCBI): 4137 RRID: AB_2881863 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10636 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.