Iright
BRAND / VENDOR: Proteintech

Proteintech, 66517-1-Ig, Caspase 2/P32/P18 Monoclonal antibody

CATALOG NUMBER: 66517-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Caspase 2/P32/P18 (66517-1-Ig) by Proteintech is a Monoclonal antibody targeting Caspase 2/P32/P18 in WB, ELISA applications with reactivity to human samples 66517-1-Ig targets Caspase 2/P32/P18 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information CASP2(Caspase-2) is also named as ICH1, NEDD2 and belongs to the peptidase C14A family.It is involved in the activation cascade of caspases responsible for apoptosis execution and might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival.It has 2 isoforms produced by alternative splicing and can exists almost as a dimer in solution(PMID:15865942).This antibody can recognize the 32 kDa pro-caspase 2 as well as 18 kDa cleaved-caspase 2. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20141 Product name: Recombinant human Caspase 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-325 aa of BC002427 Sequence: GPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDET Predict reactive species Full Name: caspase 2, apoptosis-related cysteine peptidase Calculated Molecular Weight: 452 aa, 51 kDa Observed Molecular Weight: 48-51 kDa, 32 kDa, 18 kDa GenBank Accession Number: BC002427 Gene Symbol: Caspase 2 Gene ID (NCBI): 835 RRID: AB_2881880 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P42575 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924