Iright
BRAND / VENDOR: Proteintech

Proteintech, 66539-1-Ig, RYR1 Monoclonal antibody

CATALOG NUMBER: 66539-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RYR1 (66539-1-Ig) by Proteintech is a Monoclonal antibody targeting RYR1 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 66539-1-Ig targets RYR1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse skeletal muscle tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A-673 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Background Information Ryanodine receptor isoform-1 (RyR1) is a major calcium channel in skeletal muscle important for excitation-contraction coupling. The transmembrane region of RyR1 is comprised of two domains including the pseudo voltage sensor domain and the pore-forming domain (PMID: 27855725). Dominant RyR1 mutations are the leading cause of MH. Studies on the Ca2+ conducting properties of RyR1 channels containing Malignant hyperthermia mutations expressed in myotubes. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25120 Product name: Recombinant human RYR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4942-5038 aa of NM_000540 Sequence: GELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS Predict reactive species Full Name: ryanodine receptor 1 (skeletal) Calculated Molecular Weight: 565 kDa GenBank Accession Number: NM_000540 Gene Symbol: RYR1 Gene ID (NCBI): 6261 RRID: AB_2881901 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P21817 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924