Iright
BRAND / VENDOR: Proteintech

Proteintech, 66542-1-Ig, Septin 7 Monoclonal antibody

CATALOG NUMBER: 66542-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Septin 7 (66542-1-Ig) by Proteintech is a Monoclonal antibody targeting Septin 7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66542-1-Ig targets Septin 7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 tissue Positive IHC detected in: human gliomas tissue, human lung tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Septins (SEPTs) are members of a conserved family of cytoskeletal GTPases involved in various cellular processes, including cytoskeleton organization, cytokinesis, and membrane dynamics. Septin 7 is a unique septin required for filament formation. It has also been reported to be involved in migration and invasion in various cancer cells, including breast cancer and glioma. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4309 Product name: Recombinant human SEPT7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 110-417 aa of BC025987 Sequence: VIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF Predict reactive species Full Name: septin 7 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 48-51 kDa GenBank Accession Number: BC025987 Gene Symbol: Septin 7 Gene ID (NCBI): 989 RRID: AB_2881904 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16181 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924