Iright
BRAND / VENDOR: Proteintech

Proteintech, 66544-1-Ig, TWIST2 Monoclonal antibody

CATALOG NUMBER: 66544-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TWIST2 (66544-1-Ig) by Proteintech is a Monoclonal antibody targeting TWIST2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, rat, mouse, pig samples 66544-1-Ig targets TWIST2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, rat, mouse, pig samples. Tested Applications Positive WB detected in: HeLa cells, THP-1 cells, HL-60 cells, Jurkat cells, NIH/3T3 cells, K-562 cells, HSC-T6 cells Positive IHC detected in: human breast cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information TWIST2, also named as BHLHA39 and DERMO1,is a basic helix-loop-helix protein which acts as a transcriptional regulator, plays a central role in differentiation of mesodermal during embryogenesis. TWIST2 inhibits the premature or ectopic differentiation of preosteoblast cells during osteogenesis, possibly by changing the internal signal transduction response of osteoblasts to external growth factors. It is also implicated in tumorigenesis, invasion and metastasis. TWIST2 forms both homodimers(45KD) and heterodimers with E2A E proteins, and dimer partner selection is a critical mediator of TWIST function. (PMID:14724576, 16502419). Specification Tested Reactivity: Human, rat, mouse, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2348 Product name: Recombinant human TWIST2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC033168 Sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH Predict reactive species Full Name: twist homolog 2 (Drosophila) Calculated Molecular Weight: 160 aa, 18 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC033168 Gene Symbol: TWIST2 Gene ID (NCBI): 117581 RRID: AB_2881906 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8WVJ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924