Proteintech, 66555-6-Ig, Ki-67 Monoclonal antibody

Size: 20ul / 150ul The Ki-67 (66555-6-Ig) by Proteintech is a Monoclonal antibody targeting Ki-67 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66555-6-Ig targets Ki-67 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human ovary cancer tissue, human rectal cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension Background Information The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26266 Product name: Recombinant human KI67 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1201-1300 aa of NM_002417 Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK Predict reactive species Full Name: antigen identified by monoclonal antibody Ki-67 Calculated Molecular Weight: 359 kDa GenBank Accession Number: NM_002417 Gene Symbol: KI67 Gene ID (NCBI): 4288 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P46013 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.