Iright
BRAND / VENDOR: Proteintech

Proteintech, 66558-1-Ig, PLDN Monoclonal antibody

CATALOG NUMBER: 66558-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLDN (66558-1-Ig) by Proteintech is a Monoclonal antibody targeting PLDN in WB, ELISA applications with reactivity to human, mouse, rat samples 66558-1-Ig targets PLDN in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HEK-293 cells, Jurkat cells, ROS1728 cells, RAW 264.7 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Pallidin, also named as PLDN and PA, is involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. It may play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process. Pallidin interacts with syntaxin-12 which is a t-SNARE protein that mediates vesicle docking and fusion. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18095 Product name: Recombinant human PLDN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-172 aa of BC004819 Sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM Predict reactive species Full Name: pallidin homolog (mouse) Calculated Molecular Weight: 23~24 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC004819 Gene Symbol: PLDN Gene ID (NCBI): 26258 RRID: AB_2881919 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UL45 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924