Iright
BRAND / VENDOR: Proteintech

Proteintech, 66559-1-Ig, SMAD1 Monoclonal antibody

CATALOG NUMBER: 66559-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMAD1 (66559-1-Ig) by Proteintech is a Monoclonal antibody targeting SMAD1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66559-1-Ig targets SMAD1 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-1080 cells, HeLa cells, HEK-293 cells, HepG2 cells, HSC-T6 cells, RAW 264.7 cells, NIH/3T3 cells Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Transforming growth factor-β (TGF-β) superfamily is recognized as one of the largest families of secreted multifunctional peptides exerting different biological effects on a large variety of cell types, such as regulation of hormone secretion, stimulation of extracellular matrix formation, the inhibition of proliferation of many cell types, cell survival, bone formation, and chemotaxis for inflammatory cells. One of the most important proteins that modulate TGF-β ligand activity is the SMAD family proteins. SMAD1 is one of the receptor-activated Smads. It's also a signal transducers of BMP signaling and binds to several proteins involved in ubiquitin-proteasome system (UPS). Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0701 Product name: Recombinant human SMAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-229 aa of BC001878 Sequence: GWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLP Predict reactive species Full Name: SMAD family member 1 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC001878 Gene Symbol: SMAD1 Gene ID (NCBI): 4086 RRID: AB_2881920 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924