Proteintech, 66567-1-Ig, CD151 Monoclonal antibody

Size: 20ul / 150ul The CD151 (66567-1-Ig) by Proteintech is a Monoclonal antibody targeting CD151 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human samples 66567-1-Ig targets CD151 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: unboiled A431 cells, 37°C incubated A549 cells, unboiled human placenta tissue Positive IP detected in: human placenta tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25985 Product name: Recombinant human CD151 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 113-221 aa of BC001374 Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Predict reactive species Full Name: CD151 molecule (Raph blood group) Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC001374 Gene Symbol: CD151 Gene ID (NCBI): 977 RRID: AB_2881928 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48509 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.