Iright
BRAND / VENDOR: Proteintech

Proteintech, 66614-1-Ig, PPP3CB Monoclonal antibody

CATALOG NUMBER: 66614-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP3CB (66614-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP3CB in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66614-1-Ig targets PPP3CB in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, NIH/3T3 cells, fetal human brain tissue, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: HeLa cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PPP3CB is one of the three isoforms of the A subunit of calcineurin (CnA). Calcineurin is a calcium-dependent serine/threonine phosphatase. It consists of two subunits: subunit A (CnA) and subunit B (CnB). For CnA, three isoforms PPP3CA (CnAα), PPP3CB (CnAβ) and PPP3CC (CnAγ) have been identified. PPP3CB is a calcium-dependent, calmodulin-stimulated protein phosphatase. It may have a role in the calmodulin activation of calcineurin. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26987 Product name: Recombinant human PPP3CB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 365-525 aa of BC028049 Sequence: FVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ Predict reactive species Full Name: protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform Calculated Molecular Weight: 525 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC028049 Gene Symbol: PPP3CB Gene ID (NCBI): 5532 RRID: AB_2881974 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P16298 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924