Proteintech, 66657-1-Ig, ETV5 Monoclonal antibody

Size: 20ul / 150ul The ETV5 (66657-1-Ig) by Proteintech is a Monoclonal antibody targeting ETV5 in WB, ELISA applications with reactivity to Human samples 66657-1-Ig targets ETV5 in WB, chIP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: T-47D cells, HeLa cells, PC-3 cells, DU 145 cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ETS variant gene 5(ETV5) belongs to the ETS oncogene family that shares a conserved peptide, ETS domain, which mediates sequence-specific DNA binding. ETV5 is a transcription factor and is required for spermatogonial stem cell self-renewal. ETV5 can be negatively regulated by COP1, a tumor suppressor. Also it has a role in branching morphogenesis in the developing kidney Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3708 Product name: Recombinant human ETV5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-510 aa of BC007333 Sequence: SGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY Predict reactive species Full Name: ets variant 5 Calculated Molecular Weight: 510 aa, 58 kDa Observed Molecular Weight: 58-60 kDa GenBank Accession Number: BC007333 Gene Symbol: ETV5 Gene ID (NCBI): 2119 RRID: AB_2882014 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41161 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.